100%
1378 Views

Mutiny Productions - Mutiny World, Video: Female Bbw 1487 Productions Mw World Domination Vs D Fighting Bbw Domination Clips4Sale

Model / Site / Network: Mutiny Productions - Mutiny World
Categories / Tags: BBW DominationClips4SaleFemale DominationFemale FightingFemale WrestlingOilOil WrestlingWrestlingblackwidowdaviddavidangellevelilylilykatmutinymutinywrestlingmyaprowrestling
wmv (mp4 format in my store) SEXY oil wrestling match between 2 friends, look at the preview! Eve is soooo pretty! mmmmm

Related Videos

Vs Mw Topless Mutiny Oil Wrestling World Wmvp 1487 Productions David Blackwidow Angell Eve 7:03
Vs Mw Topless Mutiny Oil Wrestling World Wmvp 1487 Productions David Blackwidow Angell Eve
Lukas Mixedboxing Female Productions Mw Wrestling World Boxingfemale Estrella Mya Aaron Domination Mutinywrestling Mutiny Mixed Oilwrestling Femaleboxing 1519 Milfs Fighting Lily-Kat Oil Boxing V Felicia 6:40
Lukas Mixedboxing Female Productions Mw Wrestling World Boxingfemale Estrella Mya Aaron Domination Mutinywrestling Mutiny Mixed Oilwrestling Femaleboxing 1519 Milfs Fighting Lily-Kat Oil Boxing V Felicia
S Theatre Female Squeeze Match Sheena Wrestling Women Scissorhold Wrestle Struggle Muscular Hanz Thighs Clips4Sa Vs Domination Vanderkill Bathory Slippery Oil Battle Hungarian Strong Amazon Grappling 21:51
S Theatre Female Squeeze Match Sheena Wrestling Women Scissorhold Wrestle Struggle Muscular Hanz Thighs Clips4Sa Vs Domination Vanderkill Bathory Slippery Oil Battle Hungarian Strong Amazon Grappling
Female Fantasy Squeeze Mistress Scissors Wrestling Queen Women J Stahl Muscular Thighs Muscle Hanz Domination Squ Vanderkill Slippery Lexa Fbb Amp Amazons Oil 12:41
Female Fantasy Squeeze Mistress Scissors Wrestling Queen Women J Stahl Muscular Thighs Muscle Hanz Domination Squ Vanderkill Slippery Lexa Fbb Amp Amazons Oil
Paris & Part Oily T Naked Scissors Wrestling Women Scissorhold Tap Muscular Topless 2 Black White Petite Body Powerful Grapevine Out Choke Fingerlock Protein Oil First Grace Diana And Strong Love Abs Rear 14:30
Paris & Part Oily T Naked Scissors Wrestling Women Scissorhold Tap Muscular Topless 2 Black White Petite Body Powerful Grapevine Out Choke Fingerlock Protein Oil First Grace Diana And Strong Love Abs Rear
Kennedy Smothering / Wedgie T Naked Scissors Wrestling Breast Sitting Scissorhold Double Punching Nelson Lotion Kylie Fetish Shakti Body Grapevine Choke Full Wedgies Oil Andre Rubbing Face Head Belly Rear 15:28
Kennedy Smothering / Wedgie T Naked Scissors Wrestling Breast Sitting Scissorhold Double Punching Nelson Lotion Kylie Fetish Shakti Body Grapevine Choke Full Wedgies Oil Andre Rubbing Face Head Belly Rear
Tits Toys Huge Natural Dolce Boobs Wet Pussy Big W Sex Vibrator Fingering Gabbie Wrestling Breast Kissing Blowjob Darcie Wrestle Large Knockers Lube Pee Lesbian Shower Lotion Titty Anal Squirt Carter Oil Piss Scissoring Eating 37:42
Tits Toys Huge Natural Dolce Boobs Wet Pussy Big W Sex Vibrator Fingering Gabbie Wrestling Breast Kissing Blowjob Darcie Wrestle Large Knockers Lube Pee Lesbian Shower Lotion Titty Anal Squirt Carter Oil Piss Scissoring Eating
Vs Mw Lukas Mutiny Chubs Oil Wrestling World Wmvp Productions 1519 Estrella 6:40
Vs Mw Lukas Mutiny Chubs Oil Wrestling World Wmvp Productions 1519 Estrella
Vs Mw Domination Female Mutiny Kyle World Wmvp Productions And Tara 1461 Estrella 6:27
Vs Mw Domination Female Mutiny Kyle World Wmvp Productions And Tara 1461 Estrella
1444 Mw Vs Kat Domination Mutiny Carlos Wmv Wrestling World Formatp Lily Productions And Foot 11:56
1444 Mw Vs Kat Domination Mutiny Carlos Wmv Wrestling World Formatp Lily Productions And Foot
Vs Mw Domination Lukas Mutiny Wrestling World Mixed Wmvp Productions Male 1496 8:46
Vs Mw Domination Lukas Mutiny Wrestling World Mixed Wmvp Productions Male 1496
Aaronhummer Brookewrestling Female Lukas Carlos Productions Male Mw Rnc Wrestling World Mixedwrestling 1496 Aaron Vs Domination Bellypunching Mutinywrestling Mutiny Mixed Fighting Boxing Dominat 8:46
Aaronhummer Brookewrestling Female Lukas Carlos Productions Male Mw Rnc Wrestling World Mixedwrestling 1496 Aaron Vs Domination Bellypunching Mutinywrestling Mutiny Mixed Fighting Boxing Dominat
Female Mixedboxing Mutinyfighter Productions Tara Buttfight Mw Kyle World Boxingfemale Estrella Vs Domination Mutinywrestling Mutiny Mixed Femaleboxing Fighting Lily-Kat Boxingfight Boxing Felicia And David 1461 6:27
Female Mixedboxing Mutinyfighter Productions Tara Buttfight Mw Kyle World Boxingfemale Estrella Vs Domination Mutinywrestling Mutiny Mixed Femaleboxing Fighting Lily-Kat Boxingfight Boxing Felicia And David 1461